Recombinant Human proCathepsin D protein (ab151860)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIP EVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACW IHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASA LGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNL MQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKA YWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAV PLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLS GFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARLVDHHHH HH
    • Molecular weight
      44 kDa including tags
    • Amino acids
      19 to 412
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151860 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
    ab151860 has been 0.2 µM filtered.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 5.50
    Constituents: 0.39% MES, 0.88% Sodium chloride

General Info

  • Alternative names
    • CATD_HUMAN
    • Cathepsin D
    • cathepsin D (lysosomal aspartyl protease)
    • Cathepsin D heavy chain
    • Ceroid-lipofuscinosis, neuronal 10
    • CLN10
    • CPSD
    • ctsd
    • EC 3.4.23
    • EC 3.4.23.5
    • Lysosomal aspartyl peptidase
    • Lysosomal aspartyl protease
    • MGC2311
    • OTTHUMP00000042282
    • OTTHUMP00000196039
    • OTTHUMP00000198692
    see all
  • Function
    Acid protease active in intracellular protein breakdown. Involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease.
  • Involvement in disease
    Defects in CTSD are the cause of neuronal ceroid lipofuscinosis type 10 (CLN10) [MIM:610127]; also known as neuronal ceroid lipofuscinosis due to cathepsin D deficiency. A form of neuronal ceroid lipofuscinosis with onset at birth or early childhood. Neuronal ceroid lipofuscinoses are progressive neurodegenerative, lysosomal storage diseases characterized by intracellular accumulation of autofluorescent liposomal material, and clinically by seizures, dementia, visual loss, and/or cerebral atrophy.
  • Sequence similarities
    Belongs to the peptidase A1 family.
  • Cellular localization
    Lysosome. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

References

ab151860 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151860.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up