Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLG VHTYELAMNHLGDMTSEEVVQKM TGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCW AFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQ KNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA RVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNK HWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
    • Molecular weight
      35 kDa
    • Amino acids
      19 to 329

Specifications

Our Abpromise guarantee covers the use of ab157020 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    1000 mU/mg protein. One unit is defined as the amount of enzyme that hydrolyzes 1 µmol of substrate per minute at 37°C, pH 5.5.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Additional notes
    ab157020 is stable for several months when stored at -80°C. After activation, cathepsin is highly autoproteolytic. When not used immediately, add MMTS (Methyl methanethiosulfonate) to 1 mM final concentration for stabilization and shock freeze in liquid nitrogen. Do not store dilutions of the enzyme.
    Activity: Activity of mature protein was measured in 50mM MES, pH 5.5, containing 2.5mM EDTA and 5mM DTT. Assay was initiated by addition of substrate Z-Phe-Arg-AMC to a final concentration of 100 µM (stock solution 10 mM in DMSO). Activity was monitored by the increase of fluorescence accompanying release of the product 7-amino-4-methylcoumarin (AMC) (excitation wavelength of 360 nm; emission wavelength of 460 nm).
    Activation: Activate by adjusting procathepsin K to pH 4.0 by adding an equal volume of 100 mM sodium acetate, pH 3.9, containing 10 mM DTT, 5 mM EDTA and incubate for 40 minutes at room temperature. MMTS (methyl methanethiosulfonate) modifies cysteines by attaching its relatively small, uncharged thiomethyl blocking group to reactive sulfhydryl groups. This reversible reaction arrests the autoproteolytical process. Activity can be restored to nearly unmodified level by adding L-cysteine (~3 M excess over MMTS). 1000 mU/mg protein. One unit is defined as the amount of enzyme that hydrolyzes 1 µmol of substrate per minute at 37°C, pH 5.5.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Tris, 2.9% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Cathepsin K
    • Cathepsin O
    • Cathepsin O1
    • Cathepsin O2
    • Cathepsin X
    • CATK_HUMAN
    • Ctsk
    • CTSO
    • CTSO2
    • PKND
    • PYCD
    see all
  • Function
    Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation.
  • Tissue specificity
    Predominantly expressed in osteclasts (bones).
  • Involvement in disease
    Defects in CTSK are the cause of pycnodysostosis (PKND) [MIM:265800]. PKND is an autosomal recessive osteochondrodysplasia characterized by osteosclerosis and short stature.
  • Sequence similarities
    Belongs to the peptidase C1 family.
  • Cellular localization
    Lysosome.
  • Information by UniProt

References

This product has been referenced in:
  • Jiang T  et al. Distribution of Cathepsin K in Late Stage of Tooth Germ Development and Its Function in Degrading Enamel Matrix Proteins in Mouse. PLoS One 12:e0169857 (2017). Read more (PubMed: 28095448) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157020.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up