Recombinant Human procollagen type IIA protein (ab158154)

Overview

  • Product name
    Recombinant Human procollagen type IIA protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSAFAGLGPREKGPDPLQYMRADQAAGGLRQHDAEVDATLKSLNNQIESI RSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMET GETCVYPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPN TANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDV EIRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMD IGGPEQEFGVDIGPVCFL
    • Amino acids
      1220 to 1487
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158154 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alpha 1 type II collagen
    • Collagen II alpha 1 polypeptide
    • Procollagen type II alpha 1
  • Relevance
    Collagen type II is the most abundant protein of cartilage matrix. Two isoforms exist and collagen type IIA is involved in early development of cartilage in embryos. The collagen is produced from type II procollagen when two teloterminal propeptides are digested from the precursor and released into the circulation. Procollagen type II N-terminal propeptide is considered a marker of cartilage synthesis and the normal concentration in serum is approximately 30ng/mL.
  • Cellular localization
    Secreted

Images

  • ab158154 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158154 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158154.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up