Recombinant Human Profilin 1 protein (ab190410)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHENLYFQGGEFAGWNAYIDNLMADGTCQDAAI VGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCS VIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGG LINKKCYEMASHLRRSQY
    • Molecular weight
      18 kDa including tags
    • Amino acids
      2 to 140
    • Additional sequence information
      expressed with a small T7-His-TEV cleavage site Tag (29aa) at its N-terminal as inclusion bodies.

Specifications

Our Abpromise guarantee covers the use of ab190410 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    The final product was refolded using temperature shift inclusion body refolding technology and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    sterile-filtered, contains NaCl, KCl, EDTA, arginine, DTT and Sucrose.

General Info

  • Alternative names
    • Actin binding protein
    • ALS18
    • Epididymis tissue protein Li 184a
    • OTTHUMP00000125244
    • Pfn
    • PFN 1
    • PFN1
    • PROF1_HUMAN
    • Profilin I
    • Profilin-1
    • Profilin1
    • ProfilinI
    see all
  • Function
    Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.
  • Sequence similarities
    Belongs to the profilin family.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt

References

ab190410 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190410.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up