Recombinant Human Prohibitin protein (ab114204)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP35232
    • SpeciesHuman
    • SequenceMAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVVFDRFRGVQDIVV GEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVA SQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQV SDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVV EKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAGDIAYQ LSRSRNITYLPAGQSVLLQLPQ
    • Molecular weight56 kDa including tags
    • Amino acids1 to 272

Specifications

Our Abpromise guarantee covers the use of ab114204 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Epididymis luminal protein 215
    • Epididymis secretory sperm binding protein Li 54e
    • HEL 215
    • HEL S 54e
    • PHB
    • PHB_HUMAN
    • PHB1
    • Prohibitin
    see all
  • FunctionProhibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging.
  • Tissue specificityWidely expressed in different tissues.
  • Sequence similaritiesBelongs to the prohibitin family.
  • Developmental stageLevels of expression in fibroblasts decrease heterogeneously during cellular aging.
  • Cellular localizationMitochondrion inner membrane.
  • Information by UniProt

Recombinant Human Prohibitin protein images

  • ab114204 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Prohibitin protein (ab114204)

ab114204 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114204.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"