Recombinant Human Prohibitin protein (BSA and azide free) (ab178465)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKHHHHHHASMAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFD RFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNI TLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELI TQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQ QEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRK LEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 272
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab178465 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    Mass Spectrometry

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Mass spectrometry
    LC-MS/MS
  • Purity
    > 90 % Densitometry.
    ab178465 is purifed using Ni-NTA chromatography and filtered (0.4 µm).
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.6
    Constituents: 0.29% Sodium chloride, 99% Tris buffer

  • Reconstitution
    Add 200 µl of deionized water to prepare a working stock solution of 0.5 mg/mL and let the lyophilized pellet dissolve completely. ab178465 is not sterile. Please filter the product by an appropriate sterile filter before using it in the cell culture.

General Info

  • Alternative names
    • Epididymis luminal protein 215
    • Epididymis secretory sperm binding protein Li 54e
    • HEL 215
    • HEL S 54e
    • PHB
    • PHB_HUMAN
    • PHB1
    • Prohibitin
    see all
  • Function
    Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging.
  • Tissue specificity
    Widely expressed in different tissues.
  • Sequence similarities
    Belongs to the prohibitin family.
  • Developmental stage
    Levels of expression in fibroblasts decrease heterogeneously during cellular aging.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab178465

    1) Reduced and boiled sample, 2.5 μg/lane

    2) Non-reduced and non-boiled sample, 2.5 μg/lane.

References

ab178465 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178465.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up