Overview

  • Product name
    Recombinant Human Prol1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKLTFFLGLLALISCFTPSESQRFSRRPYLPGQLPPPPLYRPRWVPPSPP PPYDSRLNSPLSLPFVPGRVPPSSFSRFSQAVILSQLFPLESIRQPRLFP GYPNLHFPLRPYYVGPIRILKPPFPPIPFFLAIYLPISNPEPQINITTAD TTITTNPPTTATATTSTSTKPTMTISSSTVPISSTPEPATSISAATPAAS TENTTQILANRPHTVLLNATVQVTTSNQTILSSPAFKSFWQKLFAIFG
    • Amino acids
      1 to 248
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163685 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Basic proline rich lacrimal protein
    • Basic proline rich protein
    • BPLP
    • PRL1
    • Proline rich 1
    • Proline rich lacrimal 1
    • Proline rich protein 1
    see all
  • Relevance
    Opiorphin is an endogenous inhibitor of neprilysin and aminopeptidase N. Inhibits the breakdown of substance P, Mca-BK2 and Met-enkephalin by neprilysin in vitro with IC50 values of 29 µM, 33 µM and 33 µM respectively. Inhibits the breakdown of Ala-pNA by aminopeptidase N in vitro with an IC50 of 65 µM. Has a potent analgesic effect when administered to rats by intravenous injection.
  • Cellular localization
    Secreted

Images

  • ab163685 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163685 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163685.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up