Recombinant human Prolyl Endopeptidase protein (ab80376)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMHHHHHHLSLQYPDVYRDETAVQDYHGHKICDPYAWLEDPDSEQTKAFVE AQNKITVPFLEQCPIRGLYKERMTELYDYPKYSCHFKKGKRYFYFYNTGL QNQRVLYVQDSLEGEARVFLDPNILSDDGTVALRGYAFSEDGEYFAYGLS ASGSDWVTIKFMKVDGAKELPDVLERVKFSCMAWTHDGKGMFYNSYPQQD GKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEFPDEPKWMGGAELSDDG RYVLLSIREGCDPVNRLWYCDLQQESSGIAGILKWVKLIDNFEGEYDYVT NEGTVFTFKTNRQSPNYRVINIDFRDPEESKWKVLVPEHEKDVLEWIACV RSNFLVLCYLHDVKNILQLHDLTTGALLKTFPLDVGSIVGYSGQKKDTEI FYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRH MGGILAVANIRGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTS PKRLTINGGSNGGLLVAACANQRPDLFGCVIAQVGVMDMLKFHKYTIGHA WTTDYGCSDSKQHFEWLVKYSPLHNVKLPEADDIQYPSMLLLTADHDDRV VPLHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVS DMFAFIARCLNVDWIP
    • Molecular weight82 kDa
    • Amino acids2 to 710

Specifications

Our Abpromise guarantee covers the use of ab80376 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: ≥ 12 pmol/min/µg. Assay condition: 50 mM Tris (pH 7.5), 100 µg BSA, 20 µM substrate and 500 ng Prolyl Endopeptidase protein at room temperature for 30 min.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 30% Glycerol, 0.05% Tween 20, 3mM DTT, 25mM Tris HCl, 100mM Sodium chloride, pH 8

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • dJ355L5.1 (prolyl endopeptidase)
    • HGNC:9358
    • MGC16060
    • OTTHUMP00000040498
    • PE
    • PEP
    • Post proline cleaving enzyme
    • Post-proline cleaving enzyme
    • PPCE_HUMAN
    • Prep
    • Prolyl endopeptidase
    • Prolyl oligopeptidase
    see all
  • FunctionCleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long.
  • Sequence similaritiesBelongs to the peptidase S9A family.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant human Prolyl Endopeptidase protein images

  • Lane 1: ab80376 on 10% SDS-PAGE, Coomassie staining, 4µg.
    Lane 2: Protein marker.

References for Recombinant human Prolyl Endopeptidase protein (ab80376)

ab80376 has not yet been referenced specifically in any publications.

Product Wall



Assay condition: 50 mM Tris (pH 7.5), 0.1% BSA, 20 uM substrate (A-P-AMC), and 500 ng ab80376 at room temperature for 30 min.

I hope this is helpful. Please feel free to contact me again with any further questions.


We don’t think POP can cleave BSA. See below for the answer. Some information taken from references.

In humans prolyl endopeptidase is encoded by the PREP gene.[5][6] The protein encoded by this gene is a cytosolic prolyl endopeptidase ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"