Recombinant Human Properdin protein (ab114924)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGP WGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPC PVDGEWDSWGEWSPCIRRNMKS
    • Molecular weight
      39 kDa including tags
    • Amino acids
      213 to 334

Specifications

Our Abpromise guarantee covers the use of ab114924 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • BFD
    • CFP
    • Complement factor P
    • Complement factor properdin
    • Factor P
    • PFC
    • PFD
    • PROP_HUMAN
    • Properdin
    • Properdin P factor complement
    see all
  • Function
    A positive regulator of the alternate pathway of complement. It binds to and stabilizes the C3- and C5-convertase enzyme complexes.
  • Involvement in disease
    Defects in CFP are the cause of properdin deficiency (PFD) [MIM:312060]. PFD results in higher susceptibility to bacterial infections; especially to meningococcal infections. Three phenotypes have been reported: complete deficiency (type I), incomplete deficiency (type II), and dysfunction of properdin (type III).
  • Sequence similarities
    Contains 6 TSP type-1 domains.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human Properdin protein images

  • 12.5% SDS-PAGE showing ab114924 at approximately 39.05kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Properdin protein (ab114924)

ab114924 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114924.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up