Recombinant Human Proprotein convertase PC4 (ab162833)

Overview

  • Product name
    Recombinant Human Proprotein convertase PC4
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGTRSTLVAIRPLDVSTEGYNNWVFMSTHFWDENPQGVWTLGLENKGYYF NTGTLYRYTLLLYGTAEDMTARPTGPQVTSSACVQRDTEGLCQACDGPAY ILGQLCLAYCPPRFFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCRGGS PRDCTSCPPSSTLDQQQGSCMGPTTPDSRPRLRAAACPHHRCPASAMVLS LLAVTLGGPVLCGMSMDLPLYAWLSRARATPTKPQVWLPAGT
    • Amino acids
      1 to 242
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162833 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PC4
    • Pcsk4
    • PCSK4_HUMAN
    • Proprotein convertase 4
    • Proprotein convertase PC4
    • Proprotein convertase subtilisin/kexin type 4
    • SPC5
    see all
  • Function
    Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Plays a role in transcriptional coactivation. May be involved in stabilizing the multiprotein transcription complex.
  • Tissue specificity
    Placenta.
  • Sequence similarities
    Belongs to the peptidase S8 family. Furin subfamily.
    Contains 1 FU (furin-like) repeat.
  • Developmental stage
    Localized predominantly in the cytotrophoblast layer of trophoblast cells during the first trimester of pregnancy, and to the syncytiotrophoblast and stroma cells during the third trimester.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab162833 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162833 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162833.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up