Recombinant Human Prostaglandin D2 Receptor protein (ab117045)

Overview

  • Product nameRecombinant Human Prostaglandin D2 Receptor protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13258
    • SpeciesHuman
    • SequenceMKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCS RRPLRPLPSVFYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPAL DNSLCQAFAFFMSFFGLSSTLQLLAMALECWLSLGHPFFYRRHITLRLGA LVAPVVSAFSLAFCALPFMGFGKFVQYCPGTWCFIQMVHEEGSLSVLGYS VLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCTRDCAEPRADG REASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCS NSTNMESSL
    • Molecular weight66 kDa including tags
    • Amino acids1 to 359

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117045 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AS 1
    • AS1
    • ASRT 1
    • ASRT1
    • DP
    • MGC49004
    • OTTHUMP00000178986
    • PD2R_HUMAN
    • PGD receptor
    • PGD2 receptor
    • Prostaglandin D2 receptor
    • Prostaglandin D2 receptor (DP)
    • Prostanoid DP receptor
    • Ptgdr
    see all
  • FunctionReceptor for prostaglandin D2 (PGD2). The activity of this receptor is mainly mediated by G(s) proteins that stimulate adenylate cyclase, resulting in an elevation of intracellular cAMP. A mobilization of calcium is also observed, but without formation of inositol 1,4,5-trisphosphate.
  • Tissue specificityExpressed in retinal choroid, ciliary epithelium, longitudinal and circular ciliary muscles, iris, small intestine and platelet membranes.
  • Involvement in diseaseGenetic variations in PTGDR are associated with susceptibility to asthma-related traits type 1 (ASRT1) [MIM:607277]. Asthma-related traits include clinical symptoms of asthma, such as coughing, wheezing and dyspnea.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 1 family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human Prostaglandin D2 Receptor protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab117045 at approximately 65.60 kDa.

References for Recombinant Human Prostaglandin D2 Receptor protein (ab117045)

ab117045 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117045.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"