Recombinant Human 15-PGDH protein (ab99298)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, MS
Description
-
Product name
Recombinant Human 15-PGDH protein -
Purity
> 95 % SDS-PAGE.
ab99298 is purified using conventional chromatography techniques. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMHVNGKVALVTGAAQGIGRAFAEALLLKGA KVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVD HFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEG GIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNA ICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLI TLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ -
Predicted molecular weight
31 kDa including tags -
Amino acids
1 to 266 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab99298 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Mass Spectrometry
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
pH: 8.00
Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride
General Info
-
Alternative names
- 15 hydroxyprostaglandin dehydrogenase [NAD+]
- 15 PGDH
- 15-hydroxyprostaglandin dehydrogenase [NAD+]
see all -
Function
Prostaglandin inactivation. Contributes to the regulation of events that are under the control of prostaglandin levels. Catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4. Inhibits in vivo proliferation of colon cancer cells. -
Tissue specificity
Detected in colon epithelium (at protein level). -
Involvement in disease
Defects in HPGD are the cause of primary hypertrophic osteoathropathy autosomal recessive (PHOAR) [MIM:259100]; also known as pachydermoperiostosis autosomal recessive. Primary hypertrophic osteoarthropathy is characterized by digital clubbing, osterarthropathy, variable features of pachydermia, delayed closure of the fontanels, and congenital heart disease.
Defects in HPGD are the cause of cranioosteoarthropathy (COA) [MIM:259100]. Clinical features include infantile onset of swelling of the joints, digital clubbing, hyperhidrosis, delayed closure of the fontanels, periostosis, and variable patent ductus arteriosus. Pachydermia is not a prominent feature.
Defects in HPGD are a cause of isolated congenital nail clubbing (ICNC) [MIM:119900]; also called clubbing of digits or hereditary acropachy. ICNC is a rare genodermatosis characterized by enlargement of the nail plate and terminal segments of the fingers and toes, resulting from proliferation of the connective tissues between the nail matrix and the distal phalanx. It is usually symmetrical and bilateral (in some cases unilateral). In nail clubbing usually the distal end of the nail matrix is relatively high compared to the proximal end, while the nail plate is complete but its dimensions and diameter more or less vary in comparison to normal. There may be different fingers and toes involved to varying degrees. Some fingers or toes are spared, but the thumbs are almost always involved. -
Sequence similarities
Belongs to the short-chain dehydrogenases/reductases (SDR) family. -
Cellular localization
Cytoplasm. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab99298 has not yet been referenced specifically in any publications.