Recombinant Human Prostaglandin I2 Receptor protein (ab114757)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP43119
    • SpeciesHuman
    • SequenceRKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGS CVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC
    • Molecular weight36 kDa including tags
    • Amino acids296 to 386

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114757 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • IP
    • PGI receptor
    • PGI2 receptor
    • PI2R_HUMAN
    • PRIPR
    • Prostacyclin receptor
    • Prostaglandin I2 (prostacyclin) receptor (IP)
    • Prostaglandin I2 receptor
    • Prostanoid IP receptor
    • Ptgir
    see all
  • FunctionReceptor for prostacyclin (prostaglandin I2 or PGI2). The activity of this receptor is mediated by G(s) proteins which activate adenylate cyclase.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications
    Palmitoylation of either Cys-308 or Cys-311 is sufficient to maintain functional coupling to G(s) and signaling.
    Isoprenylation does not influence ligand binding but is required for efficient coupling to the effectors adenylyl cyclase and phospholipase C.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human Prostaglandin I2 Receptor protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114757 at approximately 35.64kDa.

References for Recombinant Human Prostaglandin I2 Receptor protein (ab114757)

ab114757 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114757.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"