Recombinant Human Prostate Secretory Protein/PSP (ab114477)

Overview

  • Product nameRecombinant Human Prostate Secretory Protein/PSP
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP08118
    • SpeciesHuman
    • SequenceMNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINS EWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEK KDPKKTCSVSEWII
    • Molecular weight39 kDa including tags
    • Amino acids1 to 114

Specifications

Our Abpromise guarantee covers the use of ab114477 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Beta microseminoprotein [Precursor]
    • Beta-microseminoprotein
    • HPC 13
    • HPC13
    • IGBF
    • Immunoglobulin binding factor
    • Immunoglobulin-binding factor
    • microseminoprotein beta
    • Msmb
    • MSMB_HUMAN
    • MSP
    • MSPB
    • PN 44
    • PN44
    • Prostate secreted seminal plasma protein
    • Prostate secretory protein of 94 amino acids
    • Prostate secretory protein PSP94
    • PRPS
    • PRSP
    • PSP
    • PSP 57
    • PSP-94
    • PSP57
    • PSP94
    • Seminal plasma beta inhibin
    • Seminal plasma beta-inhibin
    see all
  • Tissue specificityStrongly expressed in prostate, liver, kidney, breast and penis. Also expressed in pancreas, esophagus, stomach, deodenum, colon, trachea, lung, salivary glands and fallopian tube. PSP94 is expressed in lung and breast, whereas PSP57 is found in kidney and bladder.
  • Involvement in diseaseDefects in MSMB are the cause of susceptibility to prostate cancer hereditary type 13 (HPC13) [MIM:611928]. It is a condition associated with familial predisposition to cancer of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma.
  • Sequence similaritiesBelongs to the beta-microseminoprotein family.
  • Cellular localizationSecreted. Sperm surface.
  • Information by UniProt

Recombinant Human Prostate Secretory Protein/PSP images

  • 12.5% SDS-PAGE showing ab114477 at approximately 38.65kDa stained with Coomassie Blue.

References for Recombinant Human Prostate Secretory Protein/PSP (ab114477)

ab114477 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114477.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"