Recombinant Human Prostate Specific Antigen protein (denatured) (ab126692)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMIVGGWECEKHSQPWQVLVASRGRAV CGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHP LYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALG TTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCA GRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHY RKWIKDTIVANP
    • Molecular weight
      29 kDa including tags
    • Amino acids
      25 to 261
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab126692 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl

General Info

  • Alternative names
    • antigen, prostate-specific
    • APS
    • Gamma seminoprotein
    • Gamma-seminoprotein
    • hK3
    • Kallikrein 3
    • Kallikrein related peptidase 3
    • Kallikrein-3
    • KLK 3
    • KLK2A1
    • Klk3
    • KLK3_HUMAN
    • P-30 antigen
    • P30 antigen
    • Prostate-specific antigen
    • Psa
    • Semenogelase
    • Seminin
    see all
  • Function
    Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum.
  • Sequence similarities
    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab126692.

References

ab126692 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab126692.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up