Recombinant Human Prosurfactant Protein B (ab114372)

Overview

  • Product nameRecombinant Human Prosurfactant Protein B
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP07988
    • SpeciesHuman
    • SequenceMAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCR ALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQEC NVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEP EQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQ FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLA ERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECH LCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLV PRGWDAHTTCQALGVCGTMSSPLQCIHSPDL
    • Molecular weight69 kDa including tags
    • Amino acids1 to 381
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114372 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 18 kDa pulmonary-surfactant protein
    • 6 kDa protein
    • PSP B
    • PSPB
    • PSPB_HUMAN
    • Pulmonary surfactant apoprotein PSP-B
    • Pulmonary surfactant-associated protein B
    • Pulmonary surfactant-associated protein, 18-KD
    • Pulmonary surfactant-associated proteolipid SPL(Phe)
    • SFTB3
    • SFTP3
    • SFTPB
    • SMDP1
    • SP B
    • SP-B
    • SPB
    • surfactant protein B
    • Surfactant, pulmonary-associated protein B
    • surfactant-associated protein, pulmonary, 3
    see all
  • FunctionPulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
  • Involvement in diseasePulmonary surfactant metabolism dysfunction 1
    Respiratory distress syndrome in premature infants
  • Sequence similaritiesContains 1 saposin A-type domain.
    Contains 3 saposin B-type domains.
  • Cellular localizationSecreted, extracellular space, surface film.
  • Information by UniProt

Recombinant Human Prosurfactant Protein B images

  • 12.5% SDS-PAGE with ab114372 stained with Coomassie Blue.

References for Recombinant Human Prosurfactant Protein B (ab114372)

ab114372 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114372.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"