Recombinant Human Prosurfactant Protein C (ab114293)

Overview

  • Product name
    Recombinant Human Prosurfactant Protein C
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDVGSKEVLMESPPDYSAAPRGRFGIPRCPVHLKRLLIVVVVVVLIVVVI VGALLMGLHMSQKHTEMVLEMSIGAPEAQQRLALSEHLVTTATFSIGSTG LVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALNRKVHNFQMECSL QAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVNTLCGEVPLYYI
    • Molecular weight
      47 kDa including tags
    • Amino acids
      1 to 197

Specifications

Our Abpromise guarantee covers the use of ab114293 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BRICD6
    • BRICHOS domain containing 6
    • PSP C
    • PSPC
    • PSPC_HUMAN
    • Pulmonary surfactant apoprotein 2
    • Pulmonary surfactant apoprotein PSP C
    • pulmonary surfactant apoprotein-2 SP-C
    • Pulmonary surfactant associated protein C
    • Pulmonary surfactant associated proteolipid SPL pVal
    • Pulmonary surfactant associated proteolipid SPL(Val)
    • Pulmonary surfactant protein SP5
    • Pulmonary surfactant-associated protein C
    • Pulmonary surfactant-associated proteolipid SPL(Val)
    • SFTP 2
    • SFTP2
    • SFTPC
    • SFTPC surfactant pulmonary associated protein C
    • SMDP2
    • SP 5
    • SP C
    • SP-C
    • SP5
    • SPC
    • Surfactant associated protein pulmonary 2
    • Surfactant protein c
    • Surfactant proteolipid SPL-pVal
    • Surfactant pulmonary associated protein C
    see all
  • Function
    Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.
  • Involvement in disease
    Defects in SFTPC are the cause of pulmonary surfactant metabolism dysfunction type 2 (SMDP2) [MIM:610913]; also called pulmonary alveolar proteinosis due to surfactant protein C deficiency. A rare disease associated with progressive respiratory insufficiency and lung disease with a variable clinical course, due to impaired surfactant homeostasis. It is characterized by alveolar filling with floccular material that stains positive using the periodic acid-Schiff method and is derived from surfactant phospholipids and protein components. Excessive lipoproteins accumulation in the alveoli results in severe respiratory distress.
    Genetic variations in SFTPC are a cause of susceptibility to respiratory distress syndrome in premature infants (RDS) [MIM:267450]; also known as RDS in prematurity. RDS is a lung disease affecting usually premature newborn infants. It is characterized by deficient gas exchange, diffuse atelectasis, high-permeability lung edema and fibrin-rich alveolar deposits called 'hyaline membranes'.
  • Sequence similarities
    Contains 1 BRICHOS domain.
  • Cellular localization
    Secreted > extracellular space > surface film.
  • Information by UniProt

Recombinant Human Prosurfactant Protein C images

  • ab114293 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Prosurfactant Protein C (ab114293)

ab114293 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114293.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up