Recombinant Human Protamine 2 protein (ab159227)

Overview

  • Product name
    Recombinant Human Protamine 2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQ SHYRRRHCSRRRLHRIHRRQHRSCRRRKRRSCRHRRRHRRGCRTRKRTCR RH
    • Amino acids
      1 to 102
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159227 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Basic nuclear protein HPI1
    • Basic nuclear protein HPI2
    • Basic nuclear protein HPS1
    • Basic nuclear protein HPS2
    • Cancer/testis antigen family 94 member 2
    • CT94.2
    • PRM2
    • Protamine P2 HP2
    • Sperm histone HP2
    • Sperm histone HP3
    • Sperm histone HP4
    • Sperm histone P2
    • Sperm protamine P2
    • Sperm protamine P3
    • Sperm protamine P4
    see all
  • Relevance
    Protamines are small, arginine-rich proteins involved in the condensation of sperm chromatin. During spermiogenesis, histones are replaced by protamines (P1 and P2), resulting in sperm chromatin condensation followed by a halt to gene expression in haploid spermatids and spermatozoa. As a consequence, protamine deficiency and aberrant P1/P2 ratio have a profound effect on both fertilization and embryo development.
  • Cellular localization
    Nuclear

Images

  • ab159227 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159227 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159227.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up