Recombinant Human Proteasome 19S S5A protein (Biotin) (ab189667)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVG LITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHR QGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNT EKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLG ASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIAT TGTEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEF GQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNE AIRNAMGSLASQATKDGKKDKKEEDKK
    • Molecular weight
      43 kDa
    • Amino acids
      1 to 377
  • Conjugation
    Biotin

Specifications

Our Abpromise guarantee covers the use of ab189667 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .
    >95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie® Blue stain.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 8
    Constituents: 1.45% Sodium chloride, 5% Glycerol, 0.02% DTT, 1.19% HEPES

General Info

  • Alternative names
    • 26S protease subunit S5a
    • 26S proteasome non ATPase regulatory subunit 4
    • 26S proteasome non-ATPase regulatory subunit 4
    • 26S proteasome regulatory subunit rpn10
    • 26S proteasome regulatory subunit S5A
    • AF
    • AF 1
    • AF1
    • Angiocidin
    • Antisecretory factor 1
    • ASF
    • DS5a
    • MCB 1
    • MCB1
    • Multiubiquitin chain binding protein
    • Multiubiquitin chain-binding protein
    • OTTHUMP00000059963
    • Prosome macropain
    • Proteasome (prosome macropain) 26S subunit non ATPase 4
    • Proteasome 26S non ATPase subunit 4
    • Proteasome 26S subunit non ATPase 4
    • PSMD 4
    • Psmd4
    • PSMD4_HUMAN
    • pUB R5
    • pUBR5
    • Rpn 10
    • Rpn10
    • RPN10 homolog
    • S5A
    • S5a/antisecretory factor protein
    see all
  • Function
    Binds and presumably selects ubiquitin-conjugates for destruction. Displays selectivity for longer polyubiquitin chains. Modulates intestinal fluid secretion.
  • Sequence similarities
    Belongs to the proteasome subunit S5A family.
    Contains 2 UIM (ubiquitin-interacting motif) repeats.
    Contains 1 VWFA domain.
  • Domain
    The 2 UIM motifs are involved in the binding to a multi-ubiquitin chain in a cooperative way.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt

References

ab189667 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189667.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up