Recombinant Human Proteasome 20S alpha 3 protein (ab88125)

Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • AccessionP25788
    • SpeciesHuman
    • SequenceMSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGV EKLVLS KLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASN FRSNFGYNIPLKHL ADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDG AQLYMIDPSGVSYGYWGCAIGK ARQAAKTEIEKLQMKEMTCRDIVKEV AKIIYIVHDEVKDKAFELELSWVGELTNGR HEIVPKDIREEAEKYAKE SLKEEDESDDDNM

Specifications

Our Abpromise guarantee covers the use of ab88125 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab88125 was purified by affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • HC8
    • Macropain subunit C8
    • MGC12306
    • MGC32631
    • Multicatalytic endopeptidase complex subunit C8
    • Proteasome (prosome macropain) subunit alpha type 3
    • Proteasome alpha 3 subunit
    • Proteasome component C8
    • Proteasome subunit alpha type 3
    • Proteasome subunit alpha type-3
    • Proteasome subunit C8
    • PSA3_HUMAN
    • PSC8
    • psmA3
    see all
  • FunctionThe proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Binds to the C-terminus of CDKN1A and thereby mediates its degradation. Negatively regulates the membrane trafficking of the cell-surface thromboxane A2 receptor (TBXA2R) isoform 2.
  • Sequence similaritiesBelongs to the peptidase T1A family.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt

References for Recombinant Human Proteasome 20S alpha 3 protein (ab88125)

ab88125 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88125.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"