Recombinant Human Proteasome 20S alpha 5 protein (ab114796)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSL QEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTK EELEEVIKDI
    • Molecular weight
      38 kDa including tags
    • Amino acids
      132 to 241

Specifications

Our Abpromise guarantee covers the use of ab114796 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Macropain zeta chain
    • Multicatalytic endopeptidase complex zeta chain
    • Proteasome (prosome macropain) subunit alpha type 5
    • Proteasome alpha5 subunit
    • Proteasome component 5
    • Proteasome subunit alpha type 5
    • Proteasome subunit alpha type-5
    • Proteasome subunit zeta
    • Proteasome zeta chain
    • PSA5_HUMAN
    • PSC5
    • PSMA5
    • ZETA
    see all
  • Function
    The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.
  • Tissue specificity
    Expressed in fetal brain (at protein level).
  • Sequence similarities
    Belongs to the peptidase T1A family.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab114796 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab114796 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114796.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up