Recombinant Human Proteasome 20S alpha 5 protein (ab114796)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP28066
    • SpeciesHuman
    • SequenceAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSL QEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTK EELEEVIKDI
    • Molecular weight38 kDa including tags
    • Amino acids132 to 241

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114796 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Macropain zeta chain
    • Multicatalytic endopeptidase complex zeta chain
    • Proteasome (prosome macropain) subunit alpha type 5
    • Proteasome alpha5 subunit
    • Proteasome component 5
    • Proteasome subunit alpha type 5
    • Proteasome subunit alpha type-5
    • Proteasome subunit zeta
    • Proteasome zeta chain
    • PSA5_HUMAN
    • PSC5
    • PSMA5
    • ZETA
    see all
  • FunctionThe proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.
  • Tissue specificityExpressed in fetal brain (at protein level).
  • Sequence similaritiesBelongs to the peptidase T1A family.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human Proteasome 20S alpha 5 protein images

  • ab114796 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human Proteasome 20S alpha 5 protein (ab114796)

ab114796 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114796.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"