Recombinant Human Proteasome 20S beta 6 protein (ab116187)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP28072
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMTTIMAVQFDGGVVLGADSRTTTGSYIANR VTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTA ASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGG SGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAI AESGVERQVLLGDQIPKFAVATLPPA
    • Molecular weight24 kDa including tags
    • Amino acids35 to 239
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116187 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab116187 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride

General Info

  • Alternative names
    • DELTA
    • LMPY
    • Macropain delta chain
    • MGC5169
    • Multicatalytic endopeptidase complex delta chain
    • Proteasome (prosome macropain) subunit beta type 6
    • Proteasome beta 6 subunit
    • Proteasome catalytic subunit 1
    • Proteasome delta chain
    • Proteasome subunit beta 6
    • Proteasome subunit beta type 6
    • Proteasome subunit beta type-6
    • Proteasome subunit delta
    • Proteasome subunit Y
    • PSB6_HUMAN
    • PSMB6
    • PSY large multifunctional protease Y
    • Y
    see all
  • FunctionThe proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This unit is responsible of the peptidyl glutamyl-like activity. May catalyze basal processing of intracellular antigens.
  • Sequence similaritiesBelongs to the peptidase T1B family.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human Proteasome 20S beta 6 protein images

  • ab116187 (3µg) analysed on a 15% SDS-PAGE gel.

References for Recombinant Human Proteasome 20S beta 6 protein (ab116187)

ab116187 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116187.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"