Recombinant Human Proteasome 20S beta 7 protein (ab169907)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGEFMAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYK LPKVRKTGTTIAGV VYKDGIVLGADTRATEGMVVADKNCSKIHFISPN IYCCGAGTAADTDMTTQLISSNLELHSLST GRLPRVVTANRMLKQMLF RYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAA MA VFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFL RPYTVPNKKGTR LGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS
    • Molecular weight
      32 kDa including tags
    • Amino acids
      1 to 277
    • Tags
      T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169907 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab169907 was expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Contains NaCl, KCl, EDTA, arginine, DTT and glycerol.

General Info

  • Alternative names
    • Macropain chain Z
    • Multicatalytic endopeptidase complex chain Z
    • Proteasome (prosome macropain) subunit beta type 7
    • Proteasome beta 7 subunit
    • Proteasome catalytic subunit 2
    • Proteasome subunit alpha
    • Proteasome subunit beta 7
    • Proteasome subunit beta type-7
    • Proteasome subunit Z
    • PSB7_HUMAN
    • PSMB7
    • PUP1
    • Z
    see all
  • Function
    The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This unit is responsible of the trypsin-like activity.
  • Tissue specificity
    Expressed at a low level in colonic mucosa. Up-regulated in colorectal cancer tissues.
  • Sequence similarities
    Belongs to the peptidase T1B family.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

References

ab169907 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169907.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up