Recombinant Human Proteasome 20S LMP2 protein (ab105592)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP28065
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMTTIMAVEFDGGVVMGSDSRVSA GEAVV NRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEE PPL VLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQ P FAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGV IYLVTITAAGVDHRVILGNELPKFYDE
    • Molecular weight24 kDa including tags
    • Amino acids21 to 219
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105592 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab105592 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • Beta1i
    • Large multifunctional peptidase 2
    • Large multifunctional protease 2
    • LMP 2
    • LMP2
    • Low molecular mass protein 2
    • Macropain chain 7
    • MGC70470
    • Multicatalytic endopeptidase complex chain 7
    • OTTHUMP00000062982
    • Proteasome (prosome macropain) subunit beta type 9
    • proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2)
    • Proteasome beta 9 subunit
    • Proteasome catalytic subunit 1i
    • Proteasome chain 7
    • Proteasome related gene 2
    • Proteasome subunit beta 6i
    • Proteasome subunit beta type 9
    • Proteasome subunit beta type-9
    • Proteasome subunit beta-1i
    • PSB9_HUMAN
    • PSMB 9
    • PSMB6i
    • PSMB9
    • Really interesting new gene 12 protein
    • RING 12
    • RING12
    • RING12 protein
    see all
  • FunctionThe proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues.
  • Sequence similaritiesBelongs to the peptidase T1B family.
  • Developmental stageHighly expressed in immature dendritic cells (at protein level).
  • Post-translational
    modifications
    Autocleaved. The resulting N-terminal Thr residue of the mature subunit is responsible for the nucleophile proteolytic activity.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human Proteasome 20S LMP2 protein images

  • 15% SDS-PAGE analysis of 3µg ab105592.

References for Recombinant Human Proteasome 20S LMP2 protein (ab105592)

ab105592 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105592.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"