Recombinant Human Proteasome 26S S2 protein (ab159261)

Overview

  • Product name
    Recombinant Human Proteasome 26S S2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEEGGRDKAPVQPQQSPAAAPGGTDEKPSGKERRDAGDKDKEQELSEEDK QLQDELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLR PHYGKLKEIYENMAPGENKRFAADIISVLAMTMSGERECLKYRLVGSQEE LASWGHEYVRHLAGEVAKEWQELDDAEKVQREPLLTLVKEIVPYNMAHNA EHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYVPEPENSALLR CALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGR HGVFLELSEDVEEYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYK THLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLY KNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGI VNSGVRNECDPALALLSDYVLHNSNTMRLGSIFGLGLAYAGSNREDVLTL LLPVMGDSKSSMEVAGVTALACGMIAVGSCNGDVTSTILQTIMEKSETEL KDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAY AGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQ GVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVS NPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQ YHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVL VSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAV DVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVIL RKNPNYDL
    • Amino acids
      1 to 908
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159261 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 26S proteasome non-ATPase regulatory subunit 2
    • 26S proteasome regulatory subunit RPN1
    • 26S proteasome regulatory subunit S2
    • 26S proteasome subunit p97
    • 55.11 protein
    • MGC14274
    • P97
    • Proteasome (prosome macropain) 26S subunit non ATPase 2
    • Proteasome 26S subunit, non-ATPase, 2
    • Proteasome 26S, subunit 2
    • Protein 55.11
    • Psmd2
    • PSMD2_HUMAN
    • Rpn1
    • S2
    • TNFR associated protein 2
    • TRAP2
    • Tumor necrosis factor receptor associated protein 2
    • Tumor necrosis factor type 1 receptor-associated protein 2
    see all
  • Function
    Acts as a regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
    Binds to the intracellular domain of tumor necrosis factor type 1 receptor. The binding domain of TRAP1 and TRAP2 resides outside the death domain of TNFR1.
  • Tissue specificity
    Found in skeletal muscle, liver, heart, brain, kidney, pancreas, lung and placenta.
  • Sequence similarities
    Belongs to the proteasome subunit S2 family.
    Contains 7 PC repeats.
  • Information by UniProt

Images

  • ab159261 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159261 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159261.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up