Recombinant Human Proteasome 26S S3 protein (ab117002)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCL DIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP
    • Molecular weight
      37 kDa including tags
    • Amino acids
      435 to 534

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117002 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • 26S proteasome non ATPase regulatory subunit 3
    • 26S proteasome non-ATPase regulatory subunit 3
    • 26S proteasome regulatory subunit RPN3
    • 26S proteasome regulatory subunit S3
    • OTTHUMP00000164347
    • P58
    • Proteasome (prosome, macropain) 26S subunit non ATPase 3
    • Proteasome subunit p58
    • PSMD3
    • PSMD3_HUMAN
    • RPN3
    • S3
    • Tissue specific transplantation antigen 2
    • TSTA2
    see all
  • Function
    Acts as a regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
  • Sequence similarities
    Belongs to the proteasome subunit S3 family.
    Contains 1 PCI domain.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab117002 at approx. 36.63kDa.
    Stained with Coomassie Blue.

References

ab117002 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117002.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up