Recombinant Human Proteasome 26S S3 protein (ab117002)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCL DIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP
    • Molecular weight
      37 kDa including tags
    • Amino acids
      435 to 534

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117002 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • 26S proteasome non ATPase regulatory subunit 3
    • 26S proteasome non-ATPase regulatory subunit 3
    • 26S proteasome regulatory subunit RPN3
    • 26S proteasome regulatory subunit S3
    • OTTHUMP00000164347
    • P58
    • Proteasome (prosome, macropain) 26S subunit non ATPase 3
    • Proteasome subunit p58
    • PSMD3
    • PSMD3_HUMAN
    • RPN3
    • S3
    • Tissue specific transplantation antigen 2
    • TSTA2
    see all
  • Function
    Acts as a regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
  • Sequence similarities
    Belongs to the proteasome subunit S3 family.
    Contains 1 PCI domain.
  • Information by UniProt

Recombinant Human Proteasome 26S S3 protein images

  • 12.5% SDS-PAGE showing ab117002 at approx. 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Proteasome 26S S3 protein (ab117002)

ab117002 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117002.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up