Recombinant Human Proteasome 26S S3 protein (ab117003)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO43242
    • SpeciesHuman
    • SequenceMKQEGSARRRGADKAKPPPGGGEQEPPPPPAPQDVEMKEEAATGGGST GEADGKTAAAAAEHSQRELDTVTLEDIKEHVKQLEKAVSGKEPRFVLRAL RMLPSTSRRLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFR PRTGKAASTPLLPEVEAYLQLLVVIFMMNSKRYKEAQKISDDLMQKISTQ NRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATLRHDADGQA TLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAI QLEYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQF RQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRL RHNVIKTGVRMISLSYSRISLADIAQKLQLDSPEDAEFIVAKAIRDGVIE ASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPP KSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP
    • Molecular weight85 kDa including tags
    • Amino acids1 to 534

Specifications

Our Abpromise guarantee covers the use of ab117003 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • 26S proteasome non ATPase regulatory subunit 3
    • 26S proteasome non-ATPase regulatory subunit 3
    • 26S proteasome regulatory subunit RPN3
    • 26S proteasome regulatory subunit S3
    • OTTHUMP00000164347
    • P58
    • Proteasome (prosome, macropain) 26S subunit non ATPase 3
    • Proteasome subunit p58
    • PSMD3
    • PSMD3_HUMAN
    • RPN3
    • S3
    • Tissue specific transplantation antigen 2
    • TSTA2
    see all
  • FunctionActs as a regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
  • Sequence similaritiesBelongs to the proteasome subunit S3 family.
    Contains 1 PCI domain.
  • Information by UniProt

Recombinant Human Proteasome 26S S3 protein images

  • 12.5% SDS-PAGE showing ab117003 at approx. 87.74 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Proteasome 26S S3 protein (ab117003)

ab117003 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117003.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"