Recombinant Human Proteasome 26S S5 protein (ab159264)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAQALALLREVARLEAPLEELRALHSVLQAVPLNELRQQAAELRLGPLF SLLNENHREKTTLCVSILERLLQAMEPVHVARNLRVDLQRGLIHPDDSVK ILTLSQIGRIVENSDAVTEILNNAELLKQIVYCIGGENLSVAKAAIKSLS RISLTQAGLEALFESNLLDDLKSVMKTNDIVRYRVYELIIEISSVSPESL NYCTTSGLVTQLLRELTGEDVLVRATCIEMVTSLAYTHHGRQYLAQEGVI DQISNIIVGADSDPFSSFYLPGFVKFFGNLAVMDSPQQICERYPIFVEKV FEMIESQDPTMIGVAVDTVGILGSNVEGKQVLQKTGTRFERLLMRIGHQS KNAPVELKIRCLDAISSLLYLPPEQQTDDLLRMTESWFSSLSRDPLELFR GISSQPFPELHCAALKVFTAIANQPWAQKLMFNSPGFVEYVVDRSVEHDK ASKDAKYELVKALANSKTIAEIFGNPNYLRLRTYLSEGPYYVKPVSTTAV EGAE
    • Amino acids
      1 to 504
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159264 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 26S protease subunit S5 basic
    • 26S proteasome non-ATPase regulatory subunit 5
    • 26S proteasome subunit S5B
    • Protease 26S, subunit 5B
    • Proteasome (prosome, macropain) 26S subunit, non ATPase, 5
    • Proteasome 19S S5B
    • Proteasome 26S subunit, non ATPase, 5
    • PSMD5
    • PSMD5_HUMAN
    • S5B
    see all
  • Function
    Acts as a chaperone during the assembly of the 26S proteasome, specifically of the base subcomplex of the PA700/19S regulatory complex (RC). In the initial step of the base subcomplex assembly is part of an intermediate PSMD5:PSMC2:PSMC1:PSMD2 module which probably assembles with a PSMD10:PSMC4:PSMC5:PAAF1 module followed by dissociation of PSMD5.
  • Sequence similarities
    Belongs to the proteasome subunit S5B/HSM3 family.
  • Domain
    Rich in dileucine repeats, which have been implicated in trafficking of a variety of transmembrane proteins.
  • Information by UniProt

Images

  • ab159264 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159264 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159264.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up