Recombinant Human Proteasome beta 1 protein (ab88152)

Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • AccessionP20618
    • SpeciesHuman
    • SequenceMLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAI VA SDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEA RLKMYK HSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGK GAVYSFDPVG SYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPL SLDRAMRLVKDVFI SAAERDVYTGDALRICIVTKEGIREETVSLRKD

Specifications

Our Abpromise guarantee covers the use of ab88152 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab88152 was purified using affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • FLJ25321
    • HC5
    • KIAA1838
    • Macropain subunit C5
    • Multicatalytic endopeptidase complex subunit C5
    • Proteasome (prosome macropain) subunit beta type 1
    • Proteasome beta 1 subunit
    • Proteasome component C5
    • Proteasome gamma chain
    • Proteasome subunit beta type 1
    • Proteasome subunit beta type-1
    • Proteasome subunit HC5
    • PSB1_HUMAN
    • PSC5
    • PSMB 1
    • PSMB1
    see all
  • FunctionThe proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.
  • Sequence similaritiesBelongs to the peptidase T1B family.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt

References for Recombinant Human Proteasome beta 1 protein (ab88152)

ab88152 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88152.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"