Recombinant Human Proteasome subunit beta type 2 protein (ab116169)

Overview

  • Product name
    Recombinant Human Proteasome subunit beta type 2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMEYLIGIQGPDYVLVASDRVAASNIVQMKD DHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAA ANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKR FILNLPTFSVRIIDKNGIHDLDNISFPKQGS
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 201
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116169 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab116169 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 30% Glycerol, 0.02% DTT, 0.32% Tris HCl, 0.58% Sodium chloride

General Info

  • Alternative names
    • HC7 I
    • Macropain subunit C7 I
    • Macropain subunit C7-I
    • Multicatalytic endopeptidase complex subunit C7 1
    • Multicatalytic endopeptidase complex subunit C7 I
    • Multicatalytic endopeptidase complex subunit C7-I
    • Proteasome (prosome, macropain) subunit beta type 2
    • Proteasome beta 2 subunit
    • Proteasome component C7 I
    • Proteasome component C7-I
    • Proteasome subunit beta type-2
    • PSB2_HUMAN
    • Psmb2
    see all
  • Function
    The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit has a trypsin-like activity.
  • Sequence similarities
    Belongs to the peptidase T1B family.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human Proteasome subunit beta type 2 protein images

  • 15% SDS-PAGE showing ab116169 at approximately 24.9 kDa (3µg).

References for Recombinant Human Proteasome subunit beta type 2 protein (ab116169)

ab116169 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116169.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up