Recombinant Human Proteasome subunit beta type 4 protein (ab115721)

Overview

  • Product nameRecombinant Human Proteasome subunit beta type 4 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP28070
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMTQNPMVTGTSVLGVKFEGGVVIAADMLGS YGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGD GHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLG VAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYR DARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE
    • Molecular weight27 kDa including tags
    • Amino acids46 to 264
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115721 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab115721 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 30% Glycerol, 0.02% DTT, 0.58% Sodium chloride

General Info

  • Alternative names
    • 26 kDa prosomal protein
    • HN3
    • HsBPROS26
    • HSN3
    • Macropain beta chain
    • Multicatalytic endopeptidase complex beta chain
    • PROS-26
    • PROS26
    • Proteasome (prosome macropain) subunit beta type 4
    • Proteasome beta 4 subunit
    • Proteasome beta chain
    • Proteasome chain 3
    • Proteasome subunit beta type 4
    • Proteasome subunit beta type-4
    • Proteasome subunit HsN3
    • PSB4_HUMAN
    • PSMB 4
    • PSMB4
    see all
  • FunctionThe proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Mediates the lipopolysaccharide-induced signal macrophage proteasome (By similarity). SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1.
  • Sequence similaritiesBelongs to the peptidase T1B family.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human Proteasome subunit beta type 4 protein images

  • 15% SDS-PAGE showing ab115721 at approximately 26.6kDa (3µg).

References for Recombinant Human Proteasome subunit beta type 4 protein (ab115721)

ab115721 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab115721.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"