Recombinant Human Protein C inhibitor (ab152068)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      HRHHPREMKKRVEDLHVGATVAPSSRRDFTFDLYRALASAAPSQNIFFSP VSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQELN QPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAM KQINDYVAKQTKGKIVDLLKNLDSNAVVIMVNYIFFKAKWETSFNHKGTQ EQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNATALFIL PSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVLP SLGISNVFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTI FTFRSARLNSQRLVFNRPFLMFIVDNNILFLGKVNRPVDHHHHHH
    • Molecular weight
      45 kDa including tags
    • Amino acids
      20 to 406
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152068 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    The purity of ab152068 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE. It is lyophilized from a 0.2 µM filtered solution.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 5.50
    Constituents: 0.39% MES, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS.
    It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
    Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • Acrosomal serine protease inhibitor
    • IPSP
    • IPSP_HUMAN
    • PAI 3
    • PAI-3
    • PAI3
    • PCI
    • PCI-B
    • PLANH 3
    • PLANH3
    • Plasma serine protease inhibitor
    • Plasminogen activator inhibitor 3
    • Plasminogen activator inhibitor III
    • PROCI
    • Protein C inhibitor
    • Serpin A5
    • Serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 5
    • Serpin peptidase inhibitor clade A member 5
    • Serpina5
    see all
  • Function
    Inhibits activated protein C as well as plasminogen activators.
  • Tissue specificity
    Expressed by the liver and secreted in plasma.
  • Sequence similarities
    Belongs to the serpin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab152068 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152068.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up