Recombinant Human Protein Kinase D2 (ab153249)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQ IGLTREFVLLPAASELAHVKQLACSIVDQKFPECGFYGLYDKILLFKHDP TSANLLQLVRSSGDIQEGDLVEVVLSASATFEDFQIRPHALTVHSYRAPA FCDHCGEMLFGLVRQGLKCDGCGLNYHKRCAFSIPNNCSGARKRRLSSTS LASGHSVRLGTSESLPCTAEELSRSTTELLPRRPPSSSSSSSASSYTGRP IELDKMLLSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCKF NCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSALMDESEDSGVI PGSHSENALHASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLR EGWVVHYSNKDTLRKRHYWRLDCKCITLFQNNTTNRYYKEIPLSEILTVE SAQNFSLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPSGQGAEAARGW ETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIQENVDIATVYQ IFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVA ILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERL TKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFAR IIGEKSFRRSVVGTPAYLAPEVLLNQGYNRSLDMWSVGVIMYVSLSGTFP FNEDEDINDQIQNAAFMYPASPWSHISAGAIDLINNLLQVKMRKRYSVDK SLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARWEQFAAEHPLPGSG LPTDRDLGGACPPQDHDMQGLAERISVL
    • Amino acids
      1 to 878
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153249 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp586E0820
    • HSPC187
    • KPCD2_HUMAN
    • nPKC D2
    • nPKC-D2
    • PKD2
    • PRKD 2
    • Prkd2
    • Protein kinase D2
    • Serine/threonine protein kinase D2
    • Serine/threonine-protein kinase D2
    see all
  • Function
    Converts transient diacylglycerol (DAG) signals into prolonged physiological effects, downstream of PKC. Involved in resistance to oxidative stress.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. PKD subfamily.
    Contains 1 PH domain.
    Contains 2 phorbol-ester/DAG-type zinc fingers.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylation of Ser-876 correlates with the activation status of the kinase.
    Ser-706 is probably phosphorylated by PKC.
  • Cellular localization
    Cytoplasm. Membrane. Translocation to the cell membrane is required for kinase activation.
  • Information by UniProt

Images

  • ab153249 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153249 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153249.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up