Recombinant Human Protein phosphatase 1 inhibitor 3C (ab117033)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DLPPVIPTEQKIEFCISYHANGQVFWDNNDGQNYRIVHVQWKPDGVQTQM APQDCAFHQTSPKTELESTIFGSPRLASGLFPEWQSWGRMENLASYR
    • Molecular weight
      36 kDa including tags
    • Amino acids
      221 to 317

Specifications

Our Abpromise guarantee covers the use of ab117033 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • OTTHUMP00000020089
    • Phosphatase 1, regulatory inhibitor subunit 5
    • PP1 subunit R5
    • ppp1r3c
    • PPP1R5
    • PPR3C_HUMAN
    • Protein phosphatase 1 regulatory subunit 3C
    • Protein phosphatase 1 regulatory subunit 5
    • protein phosphatase 1, regulatory (inhibitor) subunit 3C
    • Protein targeting to glycogen
    • PTG
    • R5
    see all
  • Function
    Acts as a glycogen-targeting subunit for PP1 and regulates its activity. Activates glycogen synthase, reduces glycogen phosphorylase activity and limits glycogen breakdown. Dramatically increases basal and insulin-stimulated glycogen synthesis upon overexpression in a variety of cell types.
  • Sequence similarities
    Contains 1 CBM21 (carbohydrate binding type-21) domain.
  • Domain
    The N-terminal region is required for binding to PP1, the central region is required for binding to glycogen and the C-terminal region is required for binding to glycogen phosphorylase, glycogen synthase and phosphorylase kinase.
  • Post-translational
    modifications
    Ubiquitinated by NHLRC1/malin in a EPM2A/laforin-dependent manner.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab117033 at approximately 36.30 kDa.

References

ab117033 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117033.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up