Recombinant Human Protein phosphatase 1 inhibitor subunit 2 (ab114835)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEM NILATYHPADKDYGLMKIDEPSTPYHSMMGDDEDACSDTEATEAMAPDIL ARKLAAAEGLEPKYRIQEQESSGEEDSDLSPEEREKKRQFEMKRKLHYNE GLNIKLARQLISKDLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQN KLRSS
    • Molecular weight
      49 kDa including tags
    • Amino acids
      1 to 205

Specifications

Our Abpromise guarantee covers the use of ab114835 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • IPP 2
    • IPP-2
    • IPP2
    • IPP2_HUMAN
    • MGC87148
    • Phosphatase inhibitor 2
    • Phosphoprotein phosphatase
    • Ppp1r2
    • PPP1R2 protein
    • Protein phosphatase 1 regulatory (inhibitor) subunit 2
    • Protein phosphatase 1 regulatory subunit 2
    • Protein phosphatase inhibitor 2
    see all
  • Function
    Inhibitor of protein-phosphatase 1.
  • Sequence similarities
    Belongs to the protein phosphatase inhibitor 2 family.
  • Post-translational
    modifications
    Phosphorylation on Thr-73 by GSK3 activates PP1 by dissociating the PP1-PPP1R2 complex (By similarity). Phosphorylation on Ser-44 by ATM activates PP1 by dissociating the PP1-PPP1R2 complex.
  • Information by UniProt

Recombinant Human Protein phosphatase 1 inhibitor subunit 2 images

  • ab114835 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Protein phosphatase 1 inhibitor subunit 2 (ab114835)

ab114835 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114835.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up