Recombinant Human Protein phosphatase 1 inhibitor subunit 2 (ab114835)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEM NILATYHPADKDYGLMKIDEPSTPYHSMMGDDEDACSDTEATEAMAPDIL ARKLAAAEGLEPKYRIQEQESSGEEDSDLSPEEREKKRQFEMKRKLHYNE GLNIKLARQLISKDLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQN KLRSS
    • Molecular weight
      49 kDa including tags
    • Amino acids
      1 to 205

Specifications

Our Abpromise guarantee covers the use of ab114835 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • IPP 2
    • IPP-2
    • IPP2
    • IPP2_HUMAN
    • MGC87148
    • Phosphatase inhibitor 2
    • Phosphoprotein phosphatase
    • Ppp1r2
    • PPP1R2 protein
    • Protein phosphatase 1 regulatory (inhibitor) subunit 2
    • Protein phosphatase 1 regulatory subunit 2
    • Protein phosphatase inhibitor 2
    see all
  • Function
    Inhibitor of protein-phosphatase 1.
  • Sequence similarities
    Belongs to the protein phosphatase inhibitor 2 family.
  • Post-translational
    modifications
    Phosphorylation on Thr-73 by GSK3 activates PP1 by dissociating the PP1-PPP1R2 complex (By similarity). Phosphorylation on Ser-44 by ATM activates PP1 by dissociating the PP1-PPP1R2 complex.
  • Information by UniProt

Images

  • ab114835 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114835 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114835.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up