Recombinant Human Protein phosphatase inhibitor 1 (ab117672)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ13522
    • SpeciesHuman
    • SequenceMEQDNSPRKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEI DEDRIPNPHLKSTLAMSPRQRKKMTRITPTMKELQMMVEHHLGQQQQGEE PEGAAESTGTQESRPPGIPDTEVESRLGTSGTAKKTAECIPKTHERGSKE PSTKEPSTHIPPLDSKGANSVLEHHHHHH
    • Molecular weight20 kDa including tags
    • Amino acids1 to 171
    • TagsHis tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117672 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Purity> 90 % SDS-PAGE.
    ab117672 is purified by proprietary chromatographic techniques. Purity is greater than 90% as determined by RP-HPLC and SDS-PAGE.
  • FormLiquid
  • Additional notesAlthough stable at 4°C for 4 weeks, ab117672 should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.61% Tris, 0.03% EDTA, 0.002% PMSF, 10% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • I 1
    • I-1
    • I1
    • Inhibitor 1
    • IPP 1
    • IPP-1
    • IPP1
    • Ppp1r1a
    • PPR1A_HUMAN
    • Protein phosphatase 1 regulatory (inhibitor) subunit 1A
    • Protein phosphatase 1 regulatory subunit 1A
    • Protein phosphatase inhibitor 1
    see all
  • FunctionInhibitor of protein-phosphatase 1. This protein may be important in hormonal control of glycogen metabolism. Hormones that elevate intracellular cAMP increase I-1 activity in many tissues. I-1 activation may impose cAMP control over proteins that are not directly phosphorylated by PKA. Following a rise in intracellular calcium, I-1 is inactivated by calcineurin (or PP2B). Does not inhibit type-2 phosphatases.
  • Sequence similaritiesBelongs to the protein phosphatase inhibitor 1 family.
  • Post-translational
    modifications
    Phosphorylation of Thr-35 is required for activity.
  • Information by UniProt

References for Recombinant Human Protein phosphatase inhibitor 1 (ab117672)

ab117672 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us.

I am happy to help you with your inquiry.

Do you want to use these in your lysis buffer and keep the phosphorylation side of your target protein intact? If this is the case I am sorry to confirm that the t...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"