Recombinant Human PRP19 protein (BSA and azide free) (ab172187)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQ LIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQ ELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGLIVPQAVPSSQP SVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKP EELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDK SSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQV VRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGC SLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFS ENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGTYLA LGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKF YSL
    • Molecular weight
      55 kDa
    • Amino acids
      2 to 504
    • Tags
      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab172187 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Purity
    > 90 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.29% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

General Info

  • Alternative names
    • hPso4
    • NMP200
    • Nuclear matrix protein 200
    • Nuclear matrix protein NMP200 related to splicing factor PRP19
    • pre mRNA processing factor 19
    • Pre-mRNA-processing factor 19
    • PRP19
    • PRP19/PSO4 homolog
    • PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae)
    • PRP19_HUMAN
    • PRPF19
    • PSO4
    • psoralen 4
    • Senescence evasion factor
    • SNEV
    • UBOX4
    see all
  • Function
    Plays a role in DNA double-strand break (DSB) repair and pre-mRNA splicing reaction. Binds double-stranded DNA in a sequence-nonspecific manner. Acts as a structural component of the nuclear framework. May also serve as a support for spliceosome binding and activity. Essential for spliceosome assembly in a oligomerization-dependent manner and might also be important for spliceosome stability. May have E3 ubiquitin ligase activity. The PSO4 complex is required in the DNA interstrand cross-links (ICLs) repair process. Overexpression of PRPF19 might extend the cellular life span by increasing the resistance to stress or by improving the DNA repair capacity of the cells.
  • Tissue specificity
    Ubiquitous. Weakly expressed in senescent cells of different tissue origins. Highly expressed in tumor cell lines.
  • Sequence similarities
    Belongs to the WD repeat PRP19 family.
    Contains 1 U-box domain.
    Contains 7 WD repeats.
  • Cellular localization
    Nucleus. Nucleus > nucleoplasm. Cytoplasm > cytoskeleton > spindle. Nucleoplasmic in interphase cells. Irregularly distributed in anaphase cells. In prophase cells, uniformly distributed, but not associated with condensing chromosomes. Found in extrachromosomal regions in metaphase cells. Mainly localized to the mitotic spindle apparatus when chromosomes segregate during anaphase. When nuclei reform during late telophase, uniformly distributed in daughter cells and displays no preferred association with decondensing chromatin.
  • Information by UniProt

Images

  • SDS-PAGE showing ab172187. Approx. MW ~74kDa.

References

ab172187 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172187.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up