Overview

  • Product name
    Recombinant Human PRPF3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVW EGTAKDRSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLESTD
    • Amino acids
      585 to 683
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160349 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hPrp3
    • HPRP3P
    • Pre mRNA splicing factor 3
    • Pre-mRNA-splicing factor 3
    • Precursor mRNA-processing factor 3, S. crevisiae, homolog of
    • PRP3 pre-mRNA processing factor 3 homolog (S. cerevisiae)
    • Prp3p
    • PRPF3
    • PRPF3_HUMAN
    • RP18
    • SNRNP90
    • U4/U6 small nuclear ribonucleoprotein PRP3
    • U4/U6 snRNP 90 kDa protein
    see all
  • Function
    Participates in pre-mRNA splicing. Part of the U4/U5/U6 tri-snRNP complex, one of the building blocks of the spliceosome.
  • Tissue specificity
    Highly expressed in retina, liver, kidney and blood. Detected at lower levels in heart and brain.
  • Involvement in disease
    Retinitis pigmentosa 18
  • Sequence similarities
    Contains 1 PWI domain.
  • Cellular localization
    Nucleus speckle. Colocalizes with spliceosomal snRNPs.
  • Information by UniProt

Images

  • ab160349 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160349 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160349.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up