Recombinant Human PRPF31 protein (ab161900)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTA SSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKGEKSGLMST
    • Amino acids
      400 to 499
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161900 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp566J153
    • hPrp 31
    • hPrp31
    • NY BR 99
    • Pre mRNA processing factor 31
    • Pre mRNA processing factor 31 homolog
    • Pre mRNA processing factor 31 homolog (yeast)
    • Pre-mRNA-processing factor 31
    • Precursor mRNA-processing factor 31, S. cerevisiae, homolog of
    • Protein 61K
    • PRP 31
    • PRP31
    • PRP31 pre mRNA processing factor 31 homolog
    • PRP31 pre mRNA processing factor 31 homolog (yeast)
    • PRP31_HUMAN
    • PRPF 31
    • prpf31
    • RP 11
    • RP11
    • Serologically defined breast cancer antigen NY BR 99
    • Serologically defined breast cancer antigen NY-BR-99
    • SNRNP61
    • U4/U6 small nuclear ribonucleoprotein Prp31
    • U4/U6 snRNP 61 kDa protein
    see all
  • Function
    Involved in pre-mRNA splicing. Required for U4/U6.U5 tri-snRNP formation.
  • Tissue specificity
    Ubiquitously expressed.
  • Involvement in disease
    Defects in PRPF31 are the cause of retinitis pigmentosa type 11 (RP11) [MIM:600138]. RP leads to degeneration of retinal photoreceptor cells. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. RP11 inheritance is autosomal dominant.
  • Sequence similarities
    Belongs to the PRP31 family.
    Contains 1 Nop domain.
  • Domain
    Interacts with the snRNP via the Nop domain.
    The coiled coil domain is formed by two non-contiguous helices.
  • Cellular localization
    Nucleus speckle. Nucleus > Cajal body. Predominantly found in speckles and in Cajal bodies.
  • Information by UniProt

Images

  • ab161900 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161900 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161900.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up