Overview

  • Product name
    Recombinant Human PRPF8 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRK FGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVL KLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIM MRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEED APVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSPPMPRSWLTTHLGM ARRPLSSHAASRQAPVH
    • Amino acids
      1 to 267
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153102 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 220 kDa U5 snRNP specific protein
    • 220 kDa U5 snRNP-specific protein
    • Apoptosis regulated protein 1
    • Apoptosis regulated protein 2
    • HPRP8
    • p220
    • Pre mRNA processing factor 8
    • Pre mRNA-processing factor 8, S. cerevisiae, homolog of
    • Pre-mRNA-processing-splicing factor 8
    • Precursor mRNA processing protein
    • PRP8
    • PRP8 homolog
    • PRP8 pre mRNA processing factor 8 homolog
    • PRP8_HUMAN
    • PRPC8
    • Prpf8
    • Retinitis pigmentosa 13 (autosomal dominant)
    • RP13
    • SNRNP220
    • Splicing factor Prp8
    • U5 snRNP specific protein
    • U5 snRNP specific protein (220 kD), ortholog of S. cerevisiae Prp8p
    see all
  • Function
    Central component of the spliceosome, which may play a role in aligning the pre-mRNA 5'- and 3'-exons for ligation. Interacts with U5 snRNA, and with pre-mRNA 5'-splice sites in B spliceosomes and 3'-splice sites in C spliceosomes.
  • Tissue specificity
    Widely expressed.
  • Involvement in disease
    Defects in PRPF8 are the cause of retinitis pigmentosa type 13 (RP13) [MIM:600059]. RP leads to degeneration of retinal photoreceptor cells. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. RP13 inheritance is autosomal dominant.
  • Sequence similarities
    Contains 1 MPN (JAB/Mov34) domain.
  • Domain
    The MPN domain has structural similarity with viral ribonucleases and RNase H, but unlike RNases, it does not bind any metal ions.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus speckle.
  • Information by UniProt

Images

  • ab153102 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153102 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153102.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up