Recombinant Human PRPS1L1 protein (ab165980)

Overview

  • Product name
    Recombinant Human PRPS1L1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YAEPTVLKWIRENIPEWKNCIIVSPDAGGAKRVTSIADQLNVDFALIHKE RKKANEVDCIVLVGDVNDRVAILVDDMADTCVTICLAADKLLSAGATR
    • Amino acids
      146 to 243
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165980 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • phosphoribosyl pyrophosphate synthase 1 like 1
    • phosphoribosyl pyrophosphate synthase III
    • Phosphoribosyl pyrophosphate synthetase 1 like 1
    • Phosphoribosyl pyrophosphate synthetase III
    • Phosphoribosylpyrophosphate synthetase 1 like 1
    • Phosphoribosylpyrophosphate synthetase 3
    • phosphoribosylpyrophosphate synthetase subunit III
    • PRPS 1
    • PRPS 3
    • PRPS1
    • PRPS1 like 1
    • PRPS3
    • PRPSL
    • PRS III
    • PRSIII
    • ribose phosphate diphosphokinase catalytic chain III
    • Ribose phosphate pyrophosphokinase
    • Ribose phosphate pyrophosphokinase 3
    • Ribose phosphate pyrophosphokinase III
    see all
  • Relevance
    This intronless gene is specifically expressed in the testis, and encodes a protein that is highly homologous to the two subunits of phosphoribosylpyrophosphate synthetase encoded by human X linked genes, PRPS1 and PRPS2. These enzymes convert pyrimidine, purine or pyridine bases to the corresponding ribonucleoside monophosphates. In vitro transcription/translation and site directed mutagenesis studies indicate that translation of this mRNA initiates exclusively at a non-AUG (ACG) codon.

Images

  • ab165980 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165980 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165980.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up