Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVG DVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAIS RINNAAFEAV
    • Amino acids
      160 to 269
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159233 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 2.7.6.1
    • Phosphoribosyl pyrophosphate synthase II
    • phosphoribosyl pyrophosphate synthetase 2
    • Phosphoribosyl pyrophosphate synthetase II
    • PPRibP
    • Prps2
    • PRPS2_HUMAN
    • PRS II
    • PRS-II
    • Ribose phosphate pyrophosphokinase II
    • Ribose-phosphate pyrophosphokinase 2
    see all
  • Function
    Catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) that is essential for nucleotide synthesis.
  • Pathway
    Metabolic intermediate biosynthesis; 5-phospho-alpha-D-ribose 1-diphosphate biosynthesis; 5-phospho-alpha-D-ribose 1-diphosphate from D-ribose 5-phosphate (route I): step 1/1.
  • Sequence similarities
    Belongs to the ribose-phosphate pyrophosphokinase family.
  • Information by UniProt

Images

  • ab159233 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159233 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159233.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up