Recombinant Human PRRC2A protein (ab159909)

Overview

  • Product name
    Recombinant Human PRRC2A protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FQDYQKLSSNLGGPGSSRTPPTGRSFSGLNSRLKATPSTYSGVFRTQRVD LYQQASPPDALRWIPKPWERTGLPPREGPSRRAEEPGSRGDKEPGLPPPR
    • Amino acids
      2046 to 2145
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159909 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HLA-B-associated transcript 2
    • Large proline-rich protein BAT2
    • PRC2A_HUMAN
    • Proline-rich and coiled-coil-containing protein 2A
    • Protein G2
    • Protein PRRC2A
    • Prrc2a
    see all
  • Function
    May play a role in the regulation of pre-mRNA splicing.
  • Tissue specificity
    Limited to cell-lines of leukemic origin.
  • Developmental stage
    Broadly expressed during the 11th week of gestation, with highest levels in the central nervous system, spinal ganglia, osteoblasts and osteocytes (at protein level).
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab159909 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159909 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159909.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up