Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGRVFLTGEKANSILKRYPRANGFFEEIRQGNIERECKEEFCTFEEAREA FENNEKTKEFWSTYTKAQQGESNRGSDWFQFYLTFPLIFGLFIILLVIFL IWRCFLRNKTRRQTVTEGHIPFPQHLNIITPPPPPDEVFDSSGLSPGFLG YVVGRSDSVSTRLSNCDPPPTYEEATGQVNLQRSETEPHLDPPPEYEDIV NSNSASAIPMVPVVTTIK
    • Molecular weight
      52 kDa including tags
    • Amino acids
      1 to 218

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116989 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • PRGP1
    • Proline rich gamma carboxyglutamic acid protein 1
    • Proline rich Gla (G carboxyglutamic acid) 1
    • Proline rich Gla (G carboxyglutamic acid) polypeptide 1
    • Proline rich Gla protein 1
    • Proline-rich gamma-carboxyglutamic acid protein 1
    • Proline-rich Gla protein 1
    • PRRG1
    • TMG1
    • TMG1_HUMAN
    • Transmembrane gamma carboxyglutamic acid protein 1 [Precursor]
    • Transmembrane gamma-carboxyglutamic acid protein 1
    see all
  • Tissue specificity
    Highly expressed in the spinal cord.
  • Sequence similarities
    Contains 1 Gla (gamma-carboxy-glutamate) domain.
  • Post-translational
    modifications
    Gla residues are produced after subsequent post-translational modifications of glutamate by a vitamin K-dependent gamma-carboxylase.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116989 at approximately 51.90 kDa.
    Stained with Coomassie Blue

References

ab116989 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116989.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up