Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGRVFLTGEKANSILKRYPRANGFFEEIRQGNIERECKEEFCTFEEAREA FENNEKTKEFWSTYTKAQQGESNRGSDWFQFYLTFPLIFGLFIILLVIFL IWRCFLRNKTRRQTVTEGHIPFPQHLNIITPPPPPDEVFDSSGLSPGFLG YVVGRSDSVSTRLSNCDPPPTYEEATGQVNLQRSETEPHLDPPPEYEDIV NSNSASAIPMVPVVTTIK
    • Molecular weight
      52 kDa including tags
    • Amino acids
      1 to 218

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116989 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • PRGP1
    • Proline rich gamma carboxyglutamic acid protein 1
    • Proline rich Gla (G carboxyglutamic acid) 1
    • Proline rich Gla (G carboxyglutamic acid) polypeptide 1
    • Proline rich Gla protein 1
    • Proline-rich gamma-carboxyglutamic acid protein 1
    • Proline-rich Gla protein 1
    • PRRG1
    • TMG1
    • TMG1_HUMAN
    • Transmembrane gamma carboxyglutamic acid protein 1 [Precursor]
    • Transmembrane gamma-carboxyglutamic acid protein 1
    see all
  • Tissue specificity
    Highly expressed in the spinal cord.
  • Sequence similarities
    Contains 1 Gla (gamma-carboxy-glutamate) domain.
  • Post-translational
    modifications
    Gla residues are produced after subsequent post-translational modifications of glutamate by a vitamin K-dependent gamma-carboxylase.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human PRRG1 protein images

  • 12.5% SDS-PAGE showing ab116989 at approximately 51.90 kDa.
    Stained with Coomassie Blue

References for Recombinant Human PRRG1 protein (ab116989)

ab116989 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116989.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up