Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVA AQADENVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKK
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 90

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AGOTC
    • Homeobox protein PHOX1
    • Paired mesoderm homeo box 1
    • Paired mesoderm homeobox 1
    • paired mesoderm homeobox 1 isoform pmx-1b
    • Paired mesoderm homeobox protein 1
    • Paired related homeobox 1
    • Paired related homeobox protein 1
    • Paired-related homeobox protein 1
    • PHOX 1
    • PHOX1
    • PHOX1 1, 2
    • PMX 1
    • PMX1
    • PRRX 1
    • Prrx1
    • PRRX1_HUMAN
    • PRX 1
    • PRX-1
    • PRX1
    see all
  • Function
    Acts as a transcriptional regulator of muscle creatine kinase (MCK) and so has a role in the establishment of diverse mesodermal muscle types. The protein binds to an A/T-rich element in the muscle creatine enhancer.
  • Sequence similarities
    Belongs to the paired homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116951 at approximately 35.53kDa stained with Coomassie Blue.

References

ab116951 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up