Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVA AQADENVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKK
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 90

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AGOTC
    • Homeobox protein PHOX1
    • Paired mesoderm homeo box 1
    • Paired mesoderm homeobox 1
    • paired mesoderm homeobox 1 isoform pmx-1b
    • Paired mesoderm homeobox protein 1
    • Paired related homeobox 1
    • Paired related homeobox protein 1
    • Paired-related homeobox protein 1
    • PHOX 1
    • PHOX1
    • PHOX1 1, 2
    • PMX 1
    • PMX1
    • PRRX 1
    • Prrx1
    • PRRX1_HUMAN
    • PRX 1
    • PRX-1
    • PRX1
    see all
  • Function
    Acts as a transcriptional regulator of muscle creatine kinase (MCK) and so has a role in the establishment of diverse mesodermal muscle types. The protein binds to an A/T-rich element in the muscle creatine enhancer.
  • Sequence similarities
    Belongs to the paired homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human PRRX1 protein images

  • 12.5% SDS-PAGE showing ab116951 at approximately 35.53kDa stained with Coomassie Blue.

References for Recombinant Human PRRX1 protein (ab116951)

ab116951 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up