Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVG FLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVK WIKNTIAANS
    • Amino acids
      138 to 247
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159243 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alpha-trypsin chain 2
    • Beta-trypsin
    • Cationic trypsinogen
    • Digestive zymogen
    • Nonfunctional trypsin 1
    • Prss1
    • Serine protease 1
    • TCR V beta 4.1
    • TRP1
    • TRY1
    • TRY1_HUMAN
    • TRY4
    • TRYP1
    • Trypsin I
    • Trypsinogen 1
    • Trypsinogen A
    see all
  • Function
    Has activity against the synthetic substrates Boc-Phe-Ser-Arg-Mec, Boc-Leu-Thr-Arg-Mec, Boc-Gln-Ala-Arg-Mec and Boc-Val-Pro-Arg-Mec. The single-chain form is more active than the two-chain form against all of these substrates.
  • Involvement in disease
    Defects in PRSS1 are a cause of hereditary pancreatitis (HPC) [MIM:167800]; also known as chronic pancreatitis (CP). HPC is an autosomal dominant disease characterized by the presence of calculi in pancreatic ducts. It causes severe abdominal pain attacks.
  • Sequence similarities
    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications
    Occurs in a single-chain form and a two-chain form, produced by proteolytic cleavage after Arg-122.
  • Cellular localization
    Secreted > extracellular space.
  • Information by UniProt

Images

  • ab159243 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159243 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159243.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up