Recombinant Human PRSS21 protein (ab161209)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGARGALLLALLLARAGLRKPESQEAAPLSGPCGRRVITSRIVGGEDAEL GRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQF GQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYT KHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIIN NSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLW YQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQSGMSQPDPSWPLL FFPLLWALPLLGPV
    • Amino acids
      1 to 314
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161209 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Eosinophil serine protease 1
    • ESP-1
    • ESP1
    • Prss21
    • Serine protease 21
    • TEST_HUMAN
    • TEST1
    • Testisin
    see all
  • Function
    Could regulate proteolytic events associated with testicular germ cell maturation.
  • Tissue specificity
    Expressed predominantly in premeiotic testicular germ cells, mostly late pachytene and diplotene spermatocytes.
  • Sequence similarities
    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab161209 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161209 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161209.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up