Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNPFLILAFVGAAVAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGG SLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYN RDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSF GADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDS GGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
    • Amino acids
      1 to 247
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159245 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Brain trypsinogen
    • Mesotrypsin
    • Mesotrypsinogen
    • MTG
    • Pancreatic trypsinogen III
    • Protease, serine, 3
    • Protease, serine, 4 (trypsin 4, brain)
    • PRSS3
    • PRSS4
    • Serine protease 3
    • Serine protease 4
    • T9
    • TRY3
    • TRY3_HUMAN
    • TRY4
    • Trypsin 3
    • Trypsin III
    • Trypsin IV
    • Trypsin-3
    • Trypsinogen 4
    • Trypsinogen 5
    • Trypsinogen IV
    see all
  • Function
    Digestive protease specialized for the degradation of trypsin inhibitors. In the ileum, may be involved in defensin processing, including DEFA5.
  • Tissue specificity
    Expressed in pancreas and brain. Also expressed in Paneth cells, at the base of small intestinal crypts.
  • Sequence similarities
    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab159245 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159245 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159245.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up