Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAQKGVLGPGQLGAVAILLYLGLLRSGTGAEGAEAPCGVAPQARITGGSS AVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKL GAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYI RPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRET CNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLW YLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPRVVPQTQESQ PDSNLCGSHLAFSSAPAQGLLRPILFLPLGLALGLLSPWLSEH
    • Molecular weight
      63 kDa including tags
    • Amino acids
      1 to 343

Specifications

Our Abpromise guarantee covers the use of ab114881 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2410039E18Rik
    • AI313909
    • C79772
    • CAP1
    • Channel Activating Protease 1
    • mCAP1
    • Prostasin
    • Prostasin heavy chain
    • protease, serine, 8
    • Prss8
    • PRSS8_HUMAN
    • Serine protease 8
    see all
  • Function
    Possesses a trypsin-like cleavage specificity.
  • Tissue specificity
    Found in prostate, liver, salivary gland, kidney, lung, pancreas, colon, bronchus and renal proximal tubular cells. In the prostate gland it may be synthesized in epithelial cells, secreted into the ducts, and excreted into the seminal fluid.
  • Sequence similarities
    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
  • Cellular localization
    Cell membrane and Secreted > extracellular space. Found in the seminal fluid. Secreted after cleavage of its C-terminus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114881 at approximately 63.47kDa.
    Stained with Coomassie Blue.

References

ab114881 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114881.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up