Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ16651
    • SpeciesHuman
    • SequenceAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLS AAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGS
    • Molecular weight37 kDa including tags
    • Amino acids33 to 131

Specifications

Our Abpromise guarantee covers the use of ab114882 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2410039E18Rik
    • AI313909
    • C79772
    • CAP1
    • Channel Activating Protease 1
    • mCAP1
    • Prostasin
    • Prostasin heavy chain
    • protease, serine, 8
    • Prss8
    • PRSS8_HUMAN
    • Serine protease 8
    see all
  • FunctionPossesses a trypsin-like cleavage specificity.
  • Tissue specificityFound in prostate, liver, salivary gland, kidney, lung, pancreas, colon, bronchus and renal proximal tubular cells. In the prostate gland it may be synthesized in epithelial cells, secreted into the ducts, and excreted into the seminal fluid.
  • Sequence similaritiesBelongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
  • Cellular localizationCell membrane and Secreted > extracellular space. Found in the seminal fluid. Secreted after cleavage of its C-terminus.
  • Information by UniProt

Recombinant Human PRSS8 protein images

  • 12.5% SDS-PAGE showing ab114882 at approximately 36.52kDa.
    Stained with Coomassie Blue.

References for Recombinant Human PRSS8 protein (ab114882)

ab114882 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114882.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"